SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI5G16730.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  15368.BRADI5G16730.1
Domain Number - Region: 113-207
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000602
Family Myosin rod fragments 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI5G16730.1
Sequence length 221
Comment (Brachypodium distachyon)
Sequence
MIQLLFTLLAAEAGLVLVLLFRTPARRLALLAVDRSKRGRGPIMARTVAATMFMVLGSSG
YSIAKIRRREGDFAQLTPTDQVLASRHLLEASLMGYSLFLGLVIDRLHHYIRQIRTMKKS
MEAVTKQSKTLEEAKLQGAEEIQGYQKKISSLNEQVQAVKHQYETKTEELKTAEANTLAL
RKQSEGLLTEYERLIAENEELRNKLQSMEVRFSHSDGKKNS
Download sequence
Identical sequences I1J015
XP_003580219.1.954 15368.BRADI5G16730.1 EG:BRADI5G16730.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]