SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 156889.Mmc1_2635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  156889.Mmc1_2635
Domain Number 1 Region: 14-196
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-56
Family Methylesterase CheB, C-terminal domain 0.00016
Further Details:      
 
Weak hits

Sequence:  156889.Mmc1_2635
Domain Number - Region: 210-245
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00131
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 156889.Mmc1_2635
Sequence length 262
Comment (Magnetococcus MC-1)
Sequence
MKTDAKESEPQINWPVVGIGSSAGGLEALTSLLGGLDQDVEHSFVIIQHLSPHHRSMMVT
LLERETLLPVRDVQDGLRPARGVIYVTPENHNVILADGRFRLLTPSKQVVPKPSVNLFFR
SLAEELGELAVGVILSGTGSDGAQGVKEIKYAGGTVLVQDPEESKYDGMPRAAIETGVVD
LILPAQTIGKRLMGLALSDSGQLHFSEEGFEQAGVAGLINQLHAWTKIDFSGYKESTLSR
RVQRKRPFLPRIQFVLKVCQAF
Download sequence
Identical sequences A0LAY8
WP_011714237.1.83473 gi|117925920|ref|YP_866537.1| 156889.Mmc1_2635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]