SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 160488.PP_5266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160488.PP_5266
Domain Number 1 Region: 201-245,277-510
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.45e-46
Family CoA transferase alpha subunit-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 160488.PP_5266
Sequence length 597
Comment (Pseudomonas putida KT2440)
Sequence
MGLPLGLGKPNAFVNALYARVRELPERRLTIYTALSLGRPPLGDGLQRRFLEPFVERVFA
DYEELSYLADLRNDTLPPNIRVEQFFMQPGSLLHSESAQQDYVSSNYSHAARDINAKGLN
LIAQLVAATPEKPVHLSLACNPDITLDLLPMIAKRRAAGETILMLGQVHAELPYMPGDAE
LPIDAFDLLLDEVEQRRLFSTPNMPVGIQDHCIGLHASSLVRDGGTLQIGIGAMGDAVAA
ALLARQGDNAGYRAVLKALDVGPWQALIEREGGLDTLTHGLYGCSEMFVNGLLVLAEAGL
LRRPADEQGAILHGGFFLGPQAFYQRLREMPLEQRAQFVMTRISFINELYGQEALKRRQR
RDARFINTAFGMTLLGAGVADQLEDGRVLSGVGGQYNFVAQGHALEGGRSILLLRSWREA
GGEVTSNLFWTYGHCTIPRHLRDIVVTEYGIADLRGQTDSEVIARLLAVSDSRFQPGLIK
QAKDAGKLADDFQLEARFTDNTPQRLEAIRAQHARLFPEYPMGTDFTAEERDLLRALNWL
KSKFKLSEVLELGKAALDAPGPEGYESHLGRMQLGQPQGLKEELYQRLLLAGLAATR
Download sequence
Identical sequences 160488.PP_5266 gi|26991942|ref|NP_747367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]