SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00000219 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00000219
Domain Number 1 Region: 46-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000147
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 104-145
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000476
Family Zn2/Cys6 DNA-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00000219
Sequence length 913
Comment (Aspergillus nidulans)
Sequence
MVQLLLLHMPFCTHRTIFSDRYITIKNASMSFPSKAPRVTKDAASLHQCPECDRAYERPD
HLARHLDSHRNERNFHCPTCHRGFNRRDVLQRHRLIHTSGTPLSKHAGRAVEACEQCAIA
KASCDNDSPCNRCQRKGIPCIPRKQRHRCFRTMAKATPEAETPQGQGGSEPGVDLSTTPR
TESIAHSENRQAPPALEAGMNPLYSTASLASPVISFPTGISDQSNPVDNLSEFPAFFEHV
MMPSDLFSTGVPGVQQPRGVLDIMCDPGFTSADANLFGSGIITDLDKILEYNLSPAPTSS
DQELNTEEESTKKRVAAFRKSLWLRVPEKNQNGFSGDGQIPLRDGDMTASISSLHRSRLE
ALNIRGKLTQQMRDNIFQLVLATGGSRLSVPSFPTAESLDALIKIGISKRTETDAWIHPY
TLYRQDSRPELLTALTAAGCVCSAIPSVGKAGVLLLEIVRVSLADLVESDNSVLRDLQYF
QASMMWLDIGIFCGYKRKMQIAESHLQPLCTDQALRRAGTFDRSFYSDNQPVQALGGESI
EDAWLQWIQQESLKRLAYHLFGHDVEVAAAMNRPALTSYAEFTVPFPSARDLWLAPTATA
WKELLETKYSHAVSSNLSLRDLLSDLSILNDLPVNIDTGVVNSAVLHGLMSQVLMFRQQA
SLSDSRTNDQPVTRLWLQTRQDDLYGTLLSLEELKANQDIARSQCIKTVSENIVDAPPLA
TLICEFAMMHLHVNLDSIQRFAGQFGEMEARREYPKLREWALTKEARTSIWHAGQVLRAA
RLVLPFQLRGFDSLAIYHAILVLWVFGLLCCGEKQRDNNTNPTSGHPNLVVSLDGPETEL
IKSFINRSVGQHGLTLHFAGAENSTVFCPLSSPRLVMDVGRQVYEGNFQGATDYVPPLVE
NLRNLIHELGSLP
Download sequence
Identical sequences C8VCY7
162425.CADANIAP00000219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]