SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00007828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00007828
Domain Number 1 Region: 21-74
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000667
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 93-133
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000157
Family Zn2/Cys6 DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00007828
Sequence length 891
Comment (Aspergillus nidulans)
Sequence
MEKIELRAGREIRSHVKLPERMHSCQVCDKTYQTRGSLTRHLRNHSVNDSQHVCPTCGVA
FSRRDLLRRHVRIHRLAQNNLNTTTTSNDLATPAPRRRCHTACQPCREARVKCDGGNPCS
QCIATQTECLLGSRTGRVSRVVEKERRQEQYSHSDDGGSAGEDDKEDGDQEQDFSRVRVE
TSITAAPAMLHSPVSNVDAPIIPFLGSEDPLPDMDNIDHLAEMDFSWTDSLPCTTTSWPW
LHESLLLQGNPLLNWTNDSIYALDTGDMVPDSCPGIIPLDTAQQLPVISPTKTVTSMSAR
DDAESGSAPPSEPGKPETRLQGPDMPEFQGQAALQQDQIVEELVAYAEKRIVTPGSKLSR
SLFWQSMSIRIAEAFRIDPCDSPGSESTLNRLMQIYKENFSPLWPLLSGKEFDSSELHPL
LFLTVVSIGCMYGTSQECNFGNKLHERVRRCLAASLIGLEDAEGDILWLGRARLLTQVAA
LYFGQRRAFSYAQHVGAITLAQARRMDLFSTVGRPGMTGELSLEQQTVLWQNAEARKRLA
FGILRADVFTSVLLNTRPLLSAEEIYLDLPASDEIWMNLDTIPLEQLASRLKDESSRALG
LPFCDLVRVASDRGEALLNMNPRGYELLIFGLQEYVWRFSHDRSMFPRLIGQSDHTVAQK
ENLPSSPNGLSISASLQTDQLGRTYRRMNDLRNDRCRITQTLQRWEQSFTSTRTTQSFGQ
DRTSVMSSLLLLYISYLRLCVPLADLHSAAYILMDNKPLEPKKLQTLQEWAKGTGAVEAI
KHVCQIWSLLSQERFRTGTDKAKYNLLSFSGLHHAAVVIWTFAGVHSEPVAEVAELPGWR
DMAPISIQRDQTRSLLRAVVSLYKHLIPRGWYSFAAVAESLAAQPFPDSSR
Download sequence
Identical sequences A0A1U8QQ00 Q5ARQ5
XP_682294.1.1458 162425.CADANIAP00007828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]