SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00009415 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00009415
Domain Number 1 Region: 65-104
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000000641
Family Zn2/Cys6 DNA-binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 6-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000035
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00009415
Sequence length 453
Comment (Aspergillus nidulans)
Sequence
MLMCDHPGCTAQYRRKEHLTRHARKHAPLAQRLTCEVCSKAFDRTDSLRRHRQLHRREKE
SEGPGSRTVKACDRCHECKTRCDGGQPCGVCARKGARCTFDRSSKAGPTTGQSTGRLGPD
RPQKLYGVCETAKTLGSQAYRGGSAARQTPVSGSEIQDLLLQHESNLRERGLLGTAAAGP
LEPRSQNKDLDIDRYVGVYFSHFHYQWPLIHRAAFGRSNEPPILLLAIVMIGLWLTGEAA
ARDRAEKMHEKFLALLENRIDAWKLDGEFTDKTWPMTTYQTIVLNVIFAIIRDVPQCLVS
RFRSLLHAVTTTCLAGGLFTYAKMQALLEPTDSLVYSWTYMEEVKRLALAIFKLNHHLNT
GMLRPSDLQFPLPDSGYLWDAPETKDFYCRYHVQLESRTRVDDGPLICDIVRDVQDGKRG
LGMLFQADSWLGFAVSQAILSEKTPPSVDCMQN
Download sequence
Identical sequences C8VJV4
162425.CADANIAP00009415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]