SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI79615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI79615
Domain Number 1 Region: 183-210
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000816
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI79615
Sequence length 426
Comment (Phytophthora ramorum)
Sequence
MRGVFLTKSVWHVVNRETTPSFTDSRPKDEYVKSSNIAFGLMLLHMDADYHHVVDDCEEA
WVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSEGGNVLHHCNEVLNISAKLSSIGAKMED
EDVAICLLRSLPKSYENVVLNLEMSSAELRSQDVVKVLTNEHIKRQGEKTATVKSEDAAK
AFNTDRESRQCTYCGKLGHTIDKCWTKQKDENRGPRRGGNGNGRGRGANNAQWRNDDASY
DYGYGYDRVAFAVSLECGISTGKDMLGMWAVDSGATHHICNDKAKFAHLIERNEGELSVA
DGNKAAIMGVGTIVERVVLPNGDERDIEIKNALYVPSMSKNLLSVPQINKSDNQSCIKMT
KNPVNHGRAKHIDIKYHHIRDEVKRGEVKLEYCETSVMLADIMTKALAGPRHTELTAALG
IHGTSH
Download sequence
Identical sequences H3GRT4
164328.JGI79615 jgi|Phyra1_1|79615|fgenesh1_pg.C_scaffold_42000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]