SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI86610
Domain Number 1 Region: 80-114
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000361
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86610
Sequence length 163
Comment (Phytophthora ramorum)
Sequence
MEMKNAGCEPTEEDVCATMLRSLPSSYEALVQAFRMSVSEFKLADLVSKLIAEEVRQKDS
NRIEEATALLASKGNGKQQQKKKNARGMRKKGPFGKCFNCGKPGHYARDCRSEASPDEDV
QDQSNVAFHATEAFASECWVMNSGASAHMCKTRDAFQEYSVRG
Download sequence
Identical sequences H3H7A5
164328.JGI86610 jgi|Phyra1_1|86610|fgenesh1_pg.C_scaffold_911000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]