SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87023
Domain Number 1 Region: 415-489
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000398
Family Retroviral integrase, catalytic domain 0.083
Further Details:      
 
Domain Number 2 Region: 492-553,581-759
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000191
Family Reverse transcriptase 0.046
Further Details:      
 
Domain Number 3 Region: 138-165
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000921
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87023
Sequence length 808
Comment (Phytophthora ramorum)
Sequence
MDADYHHVVDDCEEAWVAWTRLKTLYSGSQKAGRIYLKRQLFSMEMSEGGNVLHHCSEVL
NISVKLSSIGAKMEGEDVAICLLRSLPKSYENVVLNLEMSSAELRSQDVVKVLTNEHIKR
QGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDKCWTKQKDENRGPRRGGNGNGRG
RGANNAQWRNDDASYDYGYGYDRVAYAVSLECGISMGKDMLGMWAVDSGATHHICNDKAK
FAHLIERNEGELSVADGNKAAIMGVRAIVERVVLPNGDERDIEIKNALYVPSMSKNLLSV
PQINKSGLFQVVFDGAQMRVAHKASKQVVAAANLVDGLYWLQTPQRSANAATSGKTVDLH
ARMGHAPVEVLRKMIDNDMIKDAKAPSKSSGPSVCRGCQQGKMVQKPFPSNRDKRRYDTF
ELLHFDICGPMEEESLGGSKYLLLIVDEASGCMKGFCLRAKSESEDCIKTYVTKVQTQFG
KKVKFVVDGQCVLVLVYVDDVLITGSSPELISRTKTDLKTRFDMTDSGKCAFVLGIELVD
GPDGSVTMCQRRYVDDILKRFAMDECKVVVSPVDMSTRLVPSDSVTKVNAPFREAVGALM
HLMTATRPDISYAVGYVSRFMENPQEKHWVAVKRIFRYLQGTKTHGICFKPGDKIDFRGY
SDADWAGDLADRKSTSGYAFMLMSAPVSWGTKKQSTEYIALSLAIQEGKWIHRLLCEILA
AANEMGPELMIRENNQSCIKMTKNPVNHGRAKHKDIKYHHIRDEVKRGEVKLEYCETSVM
LADIMTKALAGPRHTELTAALGIHGTSH
Download sequence
Identical sequences H3H8A9
jgi|Phyra1_1|87023|fgenesh1_pg.C_scaffold_1467000001 164328.JGI87023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]