SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87170
Domain Number 1 Region: 27-54
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000691
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87170
Sequence length 329
Comment (Phytophthora ramorum)
Sequence
VLTNEHIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTVDKCWTKQKDENRGPR
RGGNGNGRGRGANNAQWRSDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDSGAT
HHICNDKAKFAHLIERNEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKNALYVP
SMSKNLLSVPQINKSGLFQVVFDGTQMRVAHKASNQVVAAANLVDGLYWLQTPQRSANAA
TSGKTVDLHARMGHAPVEVLRKMIDNDMIKDAKAPSKSSGPSVCRGCQQGKMVQKPFPSN
RDKRRYDTFELLHFDICEKALVGWWQNAK
Download sequence
Identical sequences H3H8N4
jgi|Phyra1_1|87170|fgenesh1_pg.C_scaffold_1630000001 164328.JGI87170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]