SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164546.RALTA_B0791 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164546.RALTA_B0791
Domain Number 1 Region: 2-178
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.02e-50
Family Methylesterase CheB, C-terminal domain 0.0000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164546.RALTA_B0791
Sequence length 316
Comment (Cupriavidus taiwanensis)
Sequence
MVGTSSGGVDALRELAAGLPAGFDAAILVVLHIGANPSMLPQMLARAGPLPAHHARNGEA
VLPGVIYVAPPDHHLMIDGERTVLRRGPKENFARPAIDPLFRSAAVTRRSRVVGAILTGQ
LDDGTAGLQAVHQCGGITIVQDPDSAYAPDMPRNALSAVSPDFVLPLAAIAPQLAQLAGT
TAHPAPEPPPSLLLEYAMSVGPTSVEAVKQIALPSALTCPECGGTLWEMRGVVPPRFRCH
TGHTFGLSTLRDACKNALEHTLYDALRALHEQNELYTRIAAYYMQTGDVDVARQYTDAAG
RAAASAKRIEGWLRES
Download sequence
Identical sequences B3R932
gi|194291557|ref|YP_002007464.1| 164546.RALTA_B0791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]