SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 167542.P9515_00521 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167542.P9515_00521
Domain Number 1 Region: 75-354
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.27e-63
Family Alanine racemase-like, N-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 469-576
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000241
Family Eukaryotic ODC-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 167542.P9515_00521
Sequence length 648
Comment (Prochlorococcus marinus MIT 9515)
Sequence
MTNFDSKKLNKHWTIEDSISTYGIDKWGDQYFSINSLGNISITPNRNSKKTIDLFKLVNE
IKSREINTPLILRFNDILKDRITELNNAFSQAIETYNYKNIFQGVFPIKCNQQKNVLEKI
IEYGDYWDFGLEVGSKSELLIGLSLLENKKSLLICNGYKDKKYIEIAILARKLGKQPIIV
IEQIDEVQRIIEAVKNLRSTPILGIRSKLSSKSSGRWGKSVGDNSKFGLSIPEIMLTIKE
LKEASLINEMKLLHFHIGSQISDISVIKDALQEASQIFVELSKLGAPMKYIDVGGGLGID
FDGTKTSSNTSTNYSLQNYANDVVATIKDSCEVNNIQHPIIISESGRAIVSHCSVLIFDV
LGTSHVSSQIKVSHQKKTSLIIKNLIDTHNQLKNLRNKKEDLSEIIELWNDAKKFKKDCL
VAFRLGFISLGERAYAEELTWACAKEISSHLDNEKIIHPDLSEITETLSSTYYANLSVFK
SIPDTWAINQIFPIIPIHRHLEEPICKGNFADLTCDSDGKLNNFIDNGKIKSLLNLHRPE
ENNDYLIGIFMAGAYQEALGNFHNLFGNTNVIHIDINEDNTYKIKNIIKENSKSEILELL
DYSSDNLVESIRINTEFAINNKTLSIEEARKLIDQIETSLRKSSYLSE
Download sequence
Identical sequences A2BU00
gi|123965287|ref|YP_001010368.1| 167542.P9515_00521 WP_011819378.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]