SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 167542.P9515_03541 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167542.P9515_03541
Domain Number 1 Region: 112-215
Classification Level Classification E-value
Superfamily Cell-division inhibitor MinC, C-terminal domain 8.5e-28
Family Cell-division inhibitor MinC, C-terminal domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167542.P9515_03541
Sequence length 222
Comment (Prochlorococcus marinus MIT 9515)
Sequence
MKLILRNSNNDFIKSISFAKFEAYQNFISELSSIKEPVEAHLFTANERITSNELAKLKFH
LKQLNIKFSDIYSNNRETVLSGKSLKINSSLLNNKKNINKSFLDNQSQKKDILHKGTIRS
GDRISSNGDLFIMGDVNPGAIVSANNNVYVWGKLLGTAFAGENGNKNASIASLWLNPIQL
RICEIIAIGPKEKPKHQYPEIAILEAKKIIIKPYEPIRDCNK
Download sequence
Identical sequences A2BUV2
WP_011819671.1.83733 gi|123965589|ref|YP_001010670.1| 167542.P9515_03541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]