SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 167879.CPS_5047 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167879.CPS_5047
Domain Number 1 Region: 5-66,97-261
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.4e-50
Family GidA-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 167879.CPS_5047
Sequence length 629
Comment (Colwellia psychrerythraea 34H)
Sequence
MWYQESYDVIVVGGGHAGTEASLAAARMGCKTLLLTHNIDTLGQMSCNPAIGGIGKGHLV
KEIDALGGLMATAIDHSAIQFRTLNSSKGPAVRATRAQADRILYRNYVRNTLENQENLTI
FQQPCDDLILENDRVVGVSTQMGLKFKGKSVVLTVGTFLSGLIHIGLNNYQGGRAGDPAS
VNLAAKMRDMPFRMDRLKTGTPPRLDARSLDFSVMEEQAGDTPSPVFSFMGSQADHPEQI
SCFITHTNEQTHQHIRDGLDRSPMYTGVIEGVGPRYCPSIEDKITRFADKSSHQIFVEPE
GLTTHEVYPNGISTSLPFDVQMNLVRSIKGFENAFITRPGYAIEYDYFDPRDLKQSLESK
FVQNLYFAGQINGTTGYEEAGAQGLIAGANAANRVKERDEFTLGRDQAYMGVLIDDLATL
GTKEPYRMFTSRAEYRLLLREDNADIRLTEQGRKIGLVGDTRWQRFNEKMENVELERQRL
RSTWVQKDHTKIDQINALLKTPMSKEASLEDLIRRPEVNYTDLMKIEGLGPAIEDSQASE
QIEIQTKYAGYIDRQLDEIAKKKRNEDTKIPRDFDYQQISGLSNEVVAKLKDACPETIGK
ASRISGITPAAISLLLVYLKKHGLLRKLA
Download sequence
Identical sequences Q47U38
167879.CPS_5047 CsR91 WP_011045765.1.15195 gi|71279490|ref|YP_271685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]