SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 178306.PAE1105 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  178306.PAE1105
Domain Number 1 Region: 58-118
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000994
Family NfeD domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 178306.PAE1105
Sequence length 119
Comment (Pyrobaculum aerophilum)
Sequence
MDIVVSASTLGLLGGLVVLLTFFGRIPPWLGYPIGGGLLSIYVLILVVGLKASREFRKRP
PPTASVVGKRGVVVEAEAGWALVKIEGAYWKAYCNGCAPGDVVEVVRVGDAGVEVRRVG
Download sequence
Identical sequences Q8ZXT8
178306.PAE1105 gi|18312409|ref|NP_559076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]