SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 178306.PAE3353 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  178306.PAE3353
Domain Number 1 Region: 67-427
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.49e-71
Family L-arabinose binding protein-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 178306.PAE3353
Sequence length 449
Comment (Pyrobaculum aerophilum)
Sequence
MASKTLYIGIIVAVVIIAIAAALLSMGGGQQTPTQSPTTPRPTQSPTSPTATPTQTPTQT
SPTPTKKTVYIGAALPLTGGSQSYGIGVKNAVELAVEDANKMCPNIKFELLVEDTGTNPQ
QALQKVQTLYAKGARLIVGPMTSGEVSAVKSFADQNKIIIFSPSSTSPLLGIPGDWVYRI
VPTDFAQAAAIADLLKTLGVKRAVIIYRNDAWGVGLRNAITNESNKLGINIVASQGYDPD
PKAFPTAVPEAIRKLSGALGQPGSDAAIIFVTFEDDGIAAIQAAASDPVLSKVRWIGTDG
IAYSDALIKQVGKEMAAAKMLGTIAAPDPNDPKYQEFKQRYKAKYGKDPVAYDPYGYDAA
MMLMQIACQLGTDDSDKVKATLEQWGRQGTYQGVTGKVYLDEAGDRAYPNYVIWGVALEG
GQPKYVDAAYYYGTDRKITIFDQGKQFFQ
Download sequence
Identical sequences Q8ZTA2
gi|18314012|ref|NP_560679.1| 178306.PAE3353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]