SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 186497.PF1615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  186497.PF1615
Domain Number 1 Region: 586-970
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 8.5e-148
Family Hypothetical protein PH1602 0.000000000000939
Further Details:      
 
Domain Number 2 Region: 12-106
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 3.79e-30
Family Hypothetical protein PH1602 0.00000241
Further Details:      
 
Domain Number 3 Region: 105-213,248-264,519-586
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.16e-29
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.035
Further Details:      
 
Domain Number 4 Region: 353-466
Classification Level Classification E-value
Superfamily Homing endonucleases 1.08e-18
Family Intein endonuclease 0.041
Further Details:      
 
Weak hits

Sequence:  186497.PF1615
Domain Number - Region: 253-315
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0017
Family Group I mobile intron endonuclease 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 186497.PF1615
Sequence length 970
Comment (Pyrococcus furiosus)
Sequence
MIILRVVNVAVPLKRIDKIRWEIPKFDKRMKVPGRVYADDVLIEKMRQDRTLEQAANVAM
LPGIYKYSIVMPDGHQGYGFPIGGVAAFDIKEGVISPGGIGYDINCLAPGTKVLTEHGYW
LKIEEMPEKFKLQRLRLYNIEEGHNDFSRVAFVAERNIEKDETAIRIVTETGTLIEGSED
HPVLTPQGYVYLKNIKEGDYVIVYPFEGVPYEEKKGIIIDESAFEGEDPQVIKFLKERNL
LPLRWEDPKIGTLARILGFALGDGHLGEMGGRLVLAFYGREETLRELKKDLESLGIKANL
YVREKNYRIKTESGEYSGKTVLAELRVSSRSFALLLEKLGMPRGEKTKKAYRIPVWIMEA
PLWVKRNFLAGFFGADGSIVEFKGTTPLPIHLTQAKDVALEENLKEFLYDISRILEEFGV
KTTIYKVNSKKSVTYRLSIVGEENIRNFLGKINYEYDPKKKAKGLIAYAYLKFKESVKKE
RRKAMEISKKIYEETGNIDRAYKAVKDIVNRRFVERTIYEGERNPRVPKNFLTFEEFAKE
RGYEGGFVAEKVVKVERIKPEYDRFYDIGVYHEAHNFIANGIVVHNCGVRLIRTNLTEKD
VRPKIKQLVDTLFKNVPSGVGSQGKVRLHWTQIDDVLVDGAKWAVDQGYGWERDLERLEE
GGRMEGADPDAVSQRAKQRGAPQLGSLGSGNHFLEVQVVDKIFDEEIAKAYGLFEGQVVV
MVHTGSRGLGHQVASDYLRIMERAIRKYGIPWPDRELVSVPFQSEEGQRYFSAMKAAANF
AWANRQMITHWVRESFQEVFRQDPEGDLGMEIVYDVAHNIGKVEEHEVDGKKVKVIVHRK
GATRAFPPGHEAIPKIYRDVGQPVLIPGSMGTASYVLAGTEGAMAETFGSTCHGAGRVLS
RAAATRQYRGDRIRDELLRRGIYVRAASMRVVAEEAPGAYKNVDNVVKVVSEAGIAKLVA
RMRPIGVAKG
Download sequence
Identical sequences Q8U0H4
gi|18977987|ref|NP_579344.1| Pfu-1505326-001 186497.PF1615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]