SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 187272.Mlg_0546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  187272.Mlg_0546
Domain Number - Region: 82-153
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00484
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 187272.Mlg_0546
Sequence length 167
Comment (Alkalilimnicola ehrlichei MLHE-1)
Sequence
MTEHFDPWVIWLVAGLALILADLLLAGGTSGVLLLLGLTALAGMAAALLGLGLTGQLAVA
GVAGLLLLPVVLWFMRRMSGGRSGTARRDTRVGGETYVVERWGERLGIRVLGDFFPVRLV
DPGDGPAGDRPLAPGERVRVLRFSGITAEVCRVADADRSDPADARRD
Download sequence
Identical sequences Q0AB87
WP_011628295.1.71132 187272.Mlg_0546 gi|114319707|ref|YP_741390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]