SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 187420.MTH536 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  187420.MTH536
Domain Number 1 Region: 148-395
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.82e-61
Family PFOR Pyr module 0.033
Further Details:      
 
Domain Number 2 Region: 2-170
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-20
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 3 Region: 411-504
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000013
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 187420.MTH536
Sequence length 512
Comment (Methanobacterium thermoautotrophicum)
Sequence
MSRVRGGENSTLIRVSSTPVRAFIERVDVLFALSPGAVEHMDGRVKDTLVIADEEFHEEG
AISLPIMGEAEKLGGRIFANVVAAGAAANLFGVREETFDEAVRSLFERKGPDIVEADLRA
GRKGYELGDELREHLEISIEPQPSVREHVVLNGTEAVGIGCIAGGCRFMSSYPMTPSTPL
QVFISENAAEFDMVFEQAEDEIAAINMCLGASYAGARSLVATSGSGFALMEEAVGLAGMI
ETPVVIYIGQRPGPAVGLPTRTAQEDLNLALYAGPGEFPRAILAPGKLEDAPEIAAHAFN
LADRYQIPVFLLSDQYLADLYYDLPSPQIGEEPSYHITRTWEGYRRFEFTADGISPRGIP
GYGSGTVRVDSDEHDEEGLITEDLDVRRRMVEKRNLRLEMLKDDTLKPEVYGDNSSALIC
WGSTYWLVREAIESSGADVSMVHFSQVYPLPHDTLELLESFDRTAVVENNYRGQFADLLK
LEGFEADERFRRYDGMPFSVEGVAGFIEEVLL
Download sequence
Identical sequences O26636
187420.MTH536 gi|15678564|ref|NP_275679.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]