SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 189918.Mkms_0361 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189918.Mkms_0361
Domain Number 1 Region: 12-102
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000432
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 189918.Mkms_0361
Sequence length 110
Comment (Mycobacterium KMS)
Sequence
MATPLTVNADRHTDGTPLLVAAGEIDLSNVETFTRALITVIAAADGAGGTVTVDLSAVEY
LDSAAIGALSVHADQVPQMRLVANPYLIPVLRISGIDQLATVEPAQPTDG
Download sequence
Identical sequences A0A1A0UDY1 A0A1X0GDS9 A1U9S0
gi|108797331|ref|YP_637528.1| gi|126432953|ref|YP_001068644.1| gi|119866416|ref|YP_936368.1| 164756.Mmcs_0351 164757.Mjls_0340 189918.Mkms_0361 WP_011557778.1.20321 WP_011557778.1.3374 WP_011557778.1.37251 WP_011557778.1.44017 WP_011557778.1.47369 WP_011557778.1.73225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]