SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 190485.XCC2021 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190485.XCC2021
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.01e-49
Family Methylesterase CheB, C-terminal domain 0.0000895
Further Details:      
 
Weak hits

Sequence:  190485.XCC2021
Domain Number - Region: 229-257
Classification Level Classification E-value
Superfamily YfgJ-like 0.0562
Family YfgJ-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 190485.XCC2021
Sequence length 350
Comment (Xanthomonas campestris ATCC 33913)
Sequence
MTIENNRNIVAIGGSAGASQALRTLLADLPRDLPAAVLVVLHLSPQGTGIVEMVRSAVRG
LPVHVASDGMPLVPGAVYVAVPDSHLMVDGMHVVLGRGPRENMSRPSIDALFRSVAVSHG
ARALGVLLSGMLNDGCAGLEAIQACGGAVAVQDPDDAIADDMPRNALRALTPDVVAPSAA
LGAVITDLVREPAAWPIAPSDALKLEVAIARGQPSTTEVMTQLGEPVALSCPACGGVLTK
LHTPGTLRFRCQVGHGYTAPALMSAKEGSVDEALRVALRVIEERAELVSRMAGDDRAHQP
SVASLYAARAKEYRGYADVLRSALLTSLQRPVEHGALVEDGALLTQEDQH
Download sequence
Identical sequences Q8P945
190485.XCC2021 NP_637386.1.47755 WP_011037184.1.43481 gi|21231469|ref|NP_637386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]