SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 192952.MM_3037 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  192952.MM_3037
Domain Number 1 Region: 7-134
Classification Level Classification E-value
Superfamily Transposase IS200-like 3.92e-44
Family Transposase IS200-like 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 192952.MM_3037
Sequence length 136
Comment (Methanosarcina mazei)
Sequence
MAGKEHWISARGCVYNTNYHFVWSTKYRRKILIGKIAEDLKELHEQIAKEKGVTLVTQEV
MPDHVHLFIIMHPKFAPADIVKIFKGITAKKLFEMHPEIKSRLWNGHLWNPSYYVGTCGD
TTKETVKMYIETQKVK
Download sequence
Identical sequences Q8PRR7
WP_011033671.1.49674 gi|21227831|ref|NP_633753.1| gi|21229139|ref|NP_635061.1| 192952.MM_1729 192952.MM_3037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]