SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 195102.CPE2644 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195102.CPE2644
Domain Number 1 Region: 127-188
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000000036
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0021
Further Details:      
 
Domain Number 2 Region: 193-277
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0000000000000144
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0064
Further Details:      
 
Domain Number 3 Region: 34-125
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000798
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 195102.CPE2644
Sequence length 286
Comment (Clostridium perfringens)
Sequence
MLLDSLLGINFEFDHIKLGKIKISLSTIDFLLKKFITICVIVIFMILVIKIGSKLIDKAV
QKQIDTNFKFSLDTRKANTLGTLLKSILMYSVYFIGITTILSIIFGNISWAFASVGGVAV
GLGAQSFVKDVINGIFILFDNQYNVGDYVTIEGVSGIVEVIGLRTTELRDQDGSLHIIPN
GMIRIVTNNCRGDMRVQIDIGISYSDDINKVINTINSVCDTYNKENNDITEPLKVWGVTD
LTSSSVNLRICGKVKSMKLWETEVELRKRIKMTLDKKKYMKEIITG
Download sequence
Identical sequences A0A0H2YU79 B1BXH4 B1V5S1 Q8XH41
WP_003466073.1.100517 WP_003466073.1.20964 WP_003466073.1.30163 WP_003466073.1.32463 WP_003466073.1.39851 WP_003466073.1.50147 WP_003466073.1.50713 WP_003466073.1.51349 WP_003466073.1.52260 WP_003466073.1.5234 WP_003466073.1.52659 WP_003466073.1.5667 WP_003466073.1.68380 WP_003466073.1.90682 WP_003466073.1.98368 gi|110800748|ref|YP_697334.1| 195102.CPE2644 195103.CPF_2980 gi|18311626|ref|NP_563560.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]