SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 195103.CPF_1050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195103.CPF_1050
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily RbsD-like 3.27e-46
Family RbsD-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 195103.CPF_1050
Sequence length 145
Comment (Clostridium perfringens ATCC 13124)
Sequence
MLKGVPQILSPELLKVLCEMGHSDKIVIADGNFPTESMGKECIVVRCDGHGIPELLDAIL
EVFPLDTYVENPVNLMEVMKGDNVKTPIWDEYKNIIGKHDDRGSNVISTIERFKFYEEAK
KAYAIIATGEKALYANVILQKGVVI
Download sequence
Identical sequences A0A0H2YV14 B1R9R3
WP_004456284.1.23119 WP_004456284.1.27537 WP_004456284.1.31832 WP_004456284.1.4402 WP_004456284.1.50147 WP_004456284.1.51349 gi|110801351|ref|YP_695496.1| 195103.CPF_1050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]