SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 195103.CPF_1994 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195103.CPF_1994
Domain Number 1 Region: 141-439
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.56e-69
Family NOL1/NOP2/sun 0.0000568
Further Details:      
 
Domain Number 2 Region: 2-127
Classification Level Classification E-value
Superfamily NusB-like 9.94e-33
Family RmsB N-terminal domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 195103.CPF_1994
Sequence length 442
Comment (Clostridium perfringens ATCC 13124)
Sequence
MNARKIIVEILDNVLLNGAYSNIEINKQFASNDIDPKDKGLITEVVYGTIKYKKMIDIIL
SSFVADIGKIDESVVNILRSAIYQMKFLDRVPPYAIVNEAVNLTKETEPNLAKFVNGVLR
NYLRNENKNFKVGLRNNEALCYDFSFDRWMIEMFIKQYGKEDALRILRGLNTVPYVTVRV
NTCKADYDEVYERLEEEGYDIEEGAFSPEAIIIKKGSAIEKNKLYQEGLITVQDESAMLV
APLFDLRGDEQVMDLCSAPGTKATHIGELMMNKGKVVAFDIHDHKLALIKENIDRLGLTN
VEVELGDATKINSKYINWADRVLLDVPCSGLGIIRKKPEIKWNKKNNDLTEVVKVQKEIL
KNAWNYLREGGELVYSTCTLNKKENEEVIDWFVERNSDCEVEKVFLGKADNVVYNDNGSV
TILPNKYMDGFFIAKLKKKESK
Download sequence
Identical sequences A0A0H2YSV4 A0A1U9VB68
195103.CPF_1994 WP_011590944.1.10161 WP_011590944.1.2058 WP_011590944.1.23119 WP_011590944.1.50147 gi|110800441|ref|YP_696427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]