SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 195103.CPF_2050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195103.CPF_2050
Domain Number 1 Region: 1-300
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.33e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 195103.CPF_2050
Sequence length 407
Comment (Clostridium perfringens ATCC 13124)
Sequence
MRYIVVGASAAGISGAKTLRELDKDAEIILVSKDENVYSRCILHHYISGHRDIEALDFTD
RDFFEKYNIEWKKGLEVKAIDDREHVIVLSNGESLKYDKILLATGASAFIPPVENLREAK
NVVGLRNLEDAIKIKEEAEKVKNVVVLGAGLVGIDAIAGLAFKDLNVTLVEMGDRVLPIQ
LDKYASSKYEKRFEDAGVKLKLGVRAEKVLIDENKNPKALLINTGEEIPCELIIVATGVR
SNVAFLKDSSIETDRFGLIINEKGETNARDVYGAGDITGRNPIWPTAVKEGIIAANNMVG
NEIFMEDFFGSKNTMNFLGLTTMSLGVVNAPDDSYTEEIDISGENYKKIIHKDGKIYGAI
IQGDLSYAGVLTQLIKEKIHVSKVKKPLFEIDYADFFNIKENLEYTY
Download sequence
Identical sequences A0A0H2YS34 Q9WX91
195103.CPF_2050 WP_011590958.1.10161 WP_011590958.1.2058 WP_011590958.1.20964 WP_011590958.1.30163 WP_011590958.1.50147 WP_011590958.1.52260 WP_011590958.1.5234 WP_011590958.1.52659 WP_011590958.1.68380 NYSGRC-SEC-110800143 NYSGXRC-11162i gi|110800143|ref|YP_696479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]