SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196600.VV0713 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VV0713
Domain Number 1 Region: 78-315
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.11e-80
Family Pseudouridine synthase RsuA/RluD 0.0000000106
Further Details:      
 
Domain Number 2 Region: 17-67
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.000000000106
Family YbcJ-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196600.VV0713
Sequence length 325
Comment (Vibrio vulnificus YJ016)
Sequence
MAQQIELTNTVKDSQLGQRLDQAIAELFADFSRSRLKEWLLDGKVTVDGNVVTKPRTKVM
GGEVITVLAELEDEVRWEAQDIPLDIVYEDDDILVINKPRDFVVHPGAGTPDGTVLNALL
FHCPEVAEVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVRALQKRHITREYEAIAIGRMT
AGGKVDKPIGRHATKRTLMAVSPMGKPAVTHFRVAEHFREHTRIRLRLETGRTHQIRVHM
SYLQHPLLGDAAYGGRARIPAGASEDVTAMIRNFDRQALHAVMLRFEHPITGEEMEFHAP
VPDDMVELTETLRRDAQEHGLPDEY
Download sequence
Identical sequences Q7MNK3
196600.VV0713 gi|37678897|ref|NP_933506.1| WP_011149571.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]