SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196600.VV0774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  196600.VV0774
Domain Number - Region: 151-241
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.0387
Family Iron-containing alcohol dehydrogenase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196600.VV0774
Sequence length 461
Comment (Vibrio vulnificus YJ016)
Sequence
MLCIILRLTSIPTSTGLALSSLTNPNIFTVSRLNSEVRLLLENQLGIVWLVGEISNFSAP
VSGHWYFTLKDSMAQVKCAMFRGNNRLVSFKPTNGNQVLVKARLSLYEPRGDYQLIIESM
QPEGDGRLQQQFDALKMKLASEGLFAQSSKQAIPEHPKCVGIITSKTGAALYDILDVLKR
RDPSLPVVIYPTLVQGEEAAIQIAQAIGRANSRNECDVLIVGRGGGSLEDLWCFNNEIVA
RTIAASQIPIISAVGHEIDVTIADFVADLRAPTPSAAAELVSRDNSHKDQALISREQKLR
AAWRHYLTEQNRTIVSLSHRLEKQHPRYRLMRQTQQADELQIRLQRAMEKYLAQREQKVS
RVQHKLQLLSPVRQISEQKNALARVEQKMMDAMDRKLLRLRHQIAIAAEKLDTVSPLATL
KRGYSITQSESGEVITRQSQIKTGDTLVTRLSDGEIRSTVN
Download sequence
Identical sequences 196600.VV0774 gi|37678958|ref|NP_933567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]