SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196600.VV2140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VV2140
Domain Number 1 Region: 422-666
Classification Level Classification E-value
Superfamily EAL domain-like 2.48e-64
Family EAL domain 0.0021
Further Details:      
 
Domain Number 2 Region: 126-235
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000768
Family Heme-binding PAS domain 0.064
Further Details:      
 
Domain Number 3 Region: 690-817
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000000202
Family CBS-domain pair 0.006
Further Details:      
 
Domain Number 4 Region: 254-406
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.00004
Family GGDEF domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 196600.VV2140
Sequence length 822
Comment (Vibrio vulnificus YJ016)
Sequence
MLQPSRGEWRSGEHSTQSSSYGWQWKHGDACLHVDEALFRHFWRVGLSEDVSALFWSSFA
TIDKLQLLNLLDRACQSKKSGSYRCWISLNSVSHYVLFRFVPQAENAVEGEIRKLFSVDT
KGNEFSTLFRQAFDNDHHGILLTDAATQILLCNRYFENHTGYKLNQIIGQCASILDSGKH
SDEFYQSISEEVNSKGLWQGVVLIRTFGGAIVPQELTLQKLTCDDKVYYLGLYVDFSDRL
YRLADMEHGGVELLTQLPTEKQFTQQLTVRWMDSNNDDLLMVLAFLPNFAAGDEYELKQR
LSESLEKNRVSSAVGYLGGNHFVAAIECNKSQGPNQVQIIHQTIRKFFAQLTHLSGEEVQ
NALLRGKVGVSILGHDTQNPKVMVSHAVQAMLEHDGQHKGMITFYHGSIHREVLRRRELE
ELVVRSIKEESVEVFYQPIIDTATWDIAKFEALCRFKDKHGQWQNTQELVGIAEELEMVA
DLDWTVGKKSLQGLKSIHERFGTRIGITINRSLNTKLGAEEVLQNAEQMICLYCDTPELV
TVELTESAYFDSESSQSELIKRIRNMGVSVAIDDFGTGYSSFTYLSDCNFDLLKIDKEFV
TDIHVGTHKYHIVRMITELSHTLNVKVVAEGVETKQELEVLCGLGVDYIQGYFFSKPLPL
DQLHLAWNYQNQLSDFLESNESVRSMGVLRIAQSCVPQLDPQETIKQAKLLLDEGKYTVL
PIVDEGVCLGIVDRETLNLHLSPTLGTKLETTKDLAICKRTLNQVMKTQFSTVDVATKAV
EINELLKQSLPLPWVILDESGQYMGIVTHQDVLHYVSGEGLF
Download sequence
Identical sequences Q7MJM1
gi|37680324|ref|NP_934933.1| 196600.VV2140 WP_011150654.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]