SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196600.VV2561 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VV2561
Domain Number 1 Region: 2-237
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.24e-61
Family Pseudouridine synthase RsuA/RluD 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 196600.VV2561
Sequence length 245
Comment (Vibrio vulnificus YJ016)
Sequence
MLEIVYQDEYFVAVNKPAGMLVHRSWLDKHETQFVMQTLRDQIGQHVFPLHRLDRPTSGV
LVFALSSEVASQVMPMFAGQEMSKTYHAIVRGWIEEEGELDYALKVELDKIADKFASQEK
EAQDAITLYKPLAKVEVPYSTGKFPTTRYGLMELKPKTGRKHQLRRHMAHLRHPIVGDTT
HGDGKHNKLFREEFEAPRLLLHASELRFVHPYTQQEVVIRAEVDKVWQQLFERFEWPSTL
LTASH
Download sequence
Identical sequences A0A2J9Y6U6 Q7MIF6
196600.VV2561 gi|320155588|ref|YP_004187967.1| WP_011150966.1.16238 WP_011150966.1.25536 WP_011150966.1.33883 WP_011150966.1.34622 WP_011150966.1.73066 WP_011150966.1.8379 gi|37680745|ref|NP_935354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]