SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196600.VV2924 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VV2924
Domain Number 1 Region: 7-221
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.76e-62
Family Pseudouridine synthase RsuA/RluD 0.0000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 196600.VV2924
Sequence length 250
Comment (Vibrio vulnificus YJ016)
Sequence
MAMLEYLPPTDPWTEIIFEDDHILAVNKPSGLLSVPGRLPEHHDSMWSRLQEQYPEIQVV
HRLDMSTSGLMVFAKNKRAEAALKKQFQYRLTHKIYYARVWGHVETDSGMIDLPLICDWP
NRPMQKVCHEHGKPSQTEFQVAKREVHANGAQTTIMRLLPVTGRSHQLRVHMQALGHPIV
GDEFYAQGDAFTFSERLELHAAELSFYHPKSHWLRSLFVPCDFYPDAEEMIFSYFDPARK
LPDYKSLPKS
Download sequence
Identical sequences Q7MHE7
196600.VV2924 gi|37681108|ref|NP_935717.1| WP_011151233.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]