SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196600.VVA0154 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VVA0154
Domain Number 1 Region: 355-562
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.48e-59
Family Pseudouridine synthase RsuA/RluD 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196600.VVA0154
Sequence length 565
Comment (Vibrio vulnificus YJ016)
Sequence
MHTPDPCFTRFTTAIDGYALPERFTFPFYYTPHPLCVLAAEQLQQHLLTQQEWQHNFGLL
NGEVVSDDESAIGKMFGVLLVENAQGDIGFLSAFSGKIADQNLLPGFVPPVFDMLAEESF
FRRELSEITDINHQVKQLSQSAELAQLRQQIEADRQAYQAQEQAQRQAMIEGRAARKQQR
EQAEATLTGDALKAVLDDLAKQSVAEKNVLKYLKLEWDEKLASEEARLQVLLTQLDTLKA
QRKTLSNALQHKLFAQYRFLNVRGEQSDLNAIFAPTTSPVPPAGSGECAAPKLLQYAFTR
GLKPLAMAEFWWGVSPKSEVRQHKKFYPSCHSKCHPILGHMLQGLNMDPNPLEENWAEDK
ELEIVYQDEAMVVVNKPSGLLSVPGKTITDSAYARLQALFPDVEGPFVIHRLDMATSGLL
VFALTRRANKSLQKQFISRGVQKRYVALLEGEVPQSQGEITLPMRGDPDDRPRQLVCFEH
GKPAHTDWQLIEIHDGRSKLYLYPRTGRTHQLRVHCAHHLGLHMPMVGDGLYGEKANRLH
LHAESLELDHPYSKERMHFQVDAEF
Download sequence
Identical sequences Q7MG15
gi|37675814|ref|NP_936210.1| WP_011151579.1.34622 196600.VVA0154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]