SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196600.VVA1465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VVA1465
Domain Number 1 Region: 227-527
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.59e-87
Family Thermolysin-like 0.0000000087
Further Details:      
 
Domain Number 2 Region: 537-632
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000824
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 196600.VVA1465
Sequence length 636
Comment (Vibrio vulnificus YJ016)
Sequence
MVVELAVSASLREEPEEIKYNINRKSIMKHNQRHRLGLMIAAVVCSLPVTAAEMVSVSDS
AVLEQALSVQARSLAPVENGFEAVKTIQLPNGKTKVRYQQTYLGLPVFDTAVVATEGRSG
LSNVHGTMAQGLAADLPSVSVNLDQQHAIALGKQRHQAKHANAKALNTENETAQLMVRLD
ANNKAQLVYLVSFFVAEEEPSRPFMFIDANSGEILQVWDGLNHAQADGTGPGGNSKTGRY
EFGTDYPSFVIDKVGTTCTMENSVVKTVDLQNRTSGSTAYSYSCPGASNYNDHKAVNGAY
SPLNDAHYFGKVVYDMYKDWMNTAPLTFKLTMRVHYSSNYENAFWDGSAMTFGDGASTFY
PLVDINVSAHEVSHGFTEQNSGLIYSNMSGGMNEAFSDIAGEAAEFYMKGSVDWIVGADI
FKSNGGLRYFDQPSKDGRSIDHASQYYDGLNVHHSSGVYNRAFYLLANKTGWNVRKGFEI
FTLANQLYWTANSTFDAGACGVVKAAQDMGYNSNDVAEAFNQVGVNANCGVTPPSGNVLK
NNTPVSNLTGNKGSEVFYTFTVDRNATAVVSISGGSGDADLYLKAGSKPTTSSWDCRPYR
YGNNESCSVSAAPGTTYHVMIKGYSNYSGVTLKLQY
Download sequence
Identical sequences Q7MCC2
gi|37677125|ref|NP_937521.1| 196600.VVA1465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]