SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196627.cg2728 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196627.cg2728
Domain Number 1 Region: 3-307
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.84e-106
Family Glutaminase 0.00000225
Further Details:      
 
Domain Number 2 Region: 320-398
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000903
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 196627.cg2728
Sequence length 413
Comment (Corynebacterium glutamicum ATCC 13032 Bielefeld)
Sequence
MLTMPIPEYLHEILDDVRDTTSGELADYIPELKSADPNPLAVALCTVNGHIYSAGDDDIE
FTMQSISKPFAYALALQECGFDEVSASVALEPSGEAFNELSLDGENRPMNPMINAGAIAI
NQLINGSDSTVEDRVEKIRHYFSELAGRELTIDRVLAESELAGADRNLSIAHMLRNYGVI
EDEAHDAVLSYTLQCAIKVTTRDLAVMTATLAAGGTHPITGKKLLDARVCRLTLSVMASA
GMYDEAGQWLSTVGIPAKSGVAGGLIGILPGQLGIATFSPRLNPKGNSVRGVKIFKQLSD
DMGLHLMSTEQVSGHAVRSITRDGDTTFIQMQGAMNFSASESFLHAIVEHNFEGTEVVLD
LTRVLSFHPVAIRMIKEGLKRIRDAGFEVFILDPDDVLPDFMFSDGTICKERV
Download sequence
Identical sequences A0A072Z9Z2 A0A0F6Z7B9 A0A1B4WNH0 Q8NMT3
NP_601682.1.3765 WP_003860838.1.101982 WP_003860838.1.10402 WP_003860838.1.16698 WP_003860838.1.21641 WP_003860838.1.24504 WP_003860838.1.28154 WP_003860838.1.32149 WP_003860838.1.36395 WP_003860838.1.3871 WP_003860838.1.40227 WP_003860838.1.4395 WP_003860838.1.45669 WP_003860838.1.57609 WP_003860838.1.57855 WP_003860838.1.80527 WP_003860838.1.84807 WP_003860838.1.9512 gi|530316373|ref|YP_008402337.1| gi|62391320|ref|YP_226722.1| gi|62391320|ref|YP_226722.1| gi|62391320|ref|YP_226722.1| 196627.cg2728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]