SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 197221.tlr2413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tlr2413
Domain Number 1 Region: 61-151
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 2.88e-22
Family Ribosomal protein L9 C-domain 0.0003
Further Details:      
 
Domain Number 2 Region: 5-60
Classification Level Classification E-value
Superfamily L9 N-domain-like 5.76e-16
Family Ribosomal protein L9 N-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 197221.tlr2413
Sequence length 152
Comment (Thermosynechococcus elongatus)
Sequence
MAKRVQVVLNETVNKLGRMGQVVEVAPGYARNYLFPRGIAEPATPSALRRVERLQEKERQ
RLAALKSIAEKQKATLEKLATITISMPVGEKDMLFGSVTPQDVADAIQAITGETIDRREM
ILPEIRKLGTYTAEIKLHPEVTVKLNIQVVAD
Download sequence
Identical sequences P0A499 P0A4A0
gi|22299956|ref|NP_683203.1| 197221.tlr2413 NP_683203.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]