SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 197221.tsr2060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tsr2060
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 3.02e-19
Family Ribosomal protein L33p 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 197221.tsr2060
Sequence length 64
Comment (Thermosynechococcus elongatus)
Sequence
MAKAKGARIIITLECTECRTNPAQRSPGVSRYTTTKNRRTTTGRLELKKFCRYCNKHTIH
REIK
Download sequence
Identical sequences Q8DH99
NP_682850.1.97157 gi|22299603|ref|NP_682850.1| 197221.tsr2060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]