SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_0720 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  203124.Tery_0720
Domain Number - Region: 5-51
Classification Level Classification E-value
Superfamily PHP domain-like 0.00392
Family RNase P subunit p30 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_0720
Sequence length 68
Comment (Trichodesmium erythraeum IMS101)
Sequence
MMEPEAFHPSHSPTQVQNLKDLSKKYRLLIAGGIDYHGVNNYRKKETTLNMLPLPIELLA
PIQQAPSI
Download sequence
Identical sequences Q118C2
gi|113474564|ref|YP_720625.1| 203124.Tery_0720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]