SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_3707 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_3707
Domain Number 1 Region: 84-353
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.9e-76
Family BC ATP-binding domain-like 0.00000152
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.35e-47
Family BC N-terminal domain-like 0.0000204
Further Details:      
 
Domain Number 3 Region: 332-446
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.93e-46
Family BC C-terminal domain-like 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_3707
Sequence length 451
Comment (Trichodesmium erythraeum IMS101)
Sequence
MRFSKILIANRGEIALRILRTCEEIGIATIAVHSTIDCHALHVQLADEAVCIGEPTSSKS
YLNIPNIISAALTRDATAIHPGYGFLAENARFAEICADHDITFIGPSPAGIRAMGDKSTA
KETMQKAGVPTVPGSDGLLTDENEAVAIAEKIGFPLIIKATAGGGGRGMRLVRHPNDLSK
LFQAAQGEAEAAFGNPGVYMEKFIERPRHIEFQILADSYGNVIHLGERDCSIQRRHQKLL
EEAPSPALDPKLRQKMGEAAVKAAKSINYLGAGTVEFLLDQSGKFYFMEMNTRIQVEHPV
TEAITGLDLIAEQIRIAQGEKLQLTQKQVKFNGHAIECRINAEDPEHNFRPHPGRISGYL
PPGGPGVRMDSHVYTDYEIPPYYDSLIGKLIVWGHNRPTAIQRMKRALRECAVTGVPTTI
GFHQRILETPEFVDGEVYTNFVENIMNQDPK
Download sequence
Identical sequences Q10YA8
WP_011613097.1.43450 203124.Tery_3707 gi|113477178|ref|YP_723239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]