SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_3890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_3890
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.42e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_3890
Sequence length 113
Comment (Trichodesmium erythraeum IMS101)
Sequence
MKTVDIDIKYIILVPHQHLDLNHANDMKEQFISLRGKPSNFWIVDMANVESIDSSGLSVL
LTGLDIARKDGYRLVICNLNHPTVKLAFEIAQLDRVFQMFSNLDEIFSYFNLK
Download sequence
Identical sequences Q10XU8
203124.Tery_3890 gi|113477338|ref|YP_723399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]