SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203907.Bfl459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203907.Bfl459
Domain Number 1 Region: 8-317
Classification Level Classification E-value
Superfamily SIS domain 6.01e-50
Family mono-SIS domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203907.Bfl459
Sequence length 326
Comment (Candidatus Blochmannia floridanus)
Sequence
MINDKLLLQYAKETLAIEIDEAQHMLERLDDSIVLACRILLECKGKVIVSGMGKSGHIGK
KIAASLASTGTSAFFVHPAEALHGDLGMIGEQDVVIFISYSGYAYEIMTLMPLLSDSGIP
VIALTGDLQSPLAVGAECVLNIKRKREACPMELVPTSSSVNALMMGDALTISLMRYKGFS
TEQFARSHPGGRLGSKLLNCVHHIMRVGEHISKVFCTGTVMDAMFELSRTGLGLTAVCDI
NDHVIGVFTDGDLRRWIVQGKSLTDSVNLAMTCPGCVIDRDWKVDVALKMLHKLNITAAP
VVNKLGIIVGSINVHDLHRRCNGIIK
Download sequence
Identical sequences Q7VQX4
gi|33519910|ref|NP_878742.1| 203907.Bfl459 WP_011126725.1.13780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]