SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204536.SULAZ_0467 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204536.SULAZ_0467
Domain Number 1 Region: 198-384
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.28e-66
Family B3/B4 domain of PheRS, PheT 0.0000126
Further Details:      
 
Domain Number 2 Region: 460-680
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.73e-34
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00017
Further Details:      
 
Domain Number 3 Region: 41-186
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.31e-32
Family Myf domain 0.0059
Further Details:      
 
Domain Number 4 Region: 706-791
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.62e-18
Family Anticodon-binding domain of PheRS 0.0018
Further Details:      
 
Domain Number 5 Region: 395-468
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 5.77e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 204536.SULAZ_0467
Sequence length 802
Comment (Sulfurihydrogenibium azorense Az Fu1)
Sequence
MKVPYSWVKEFVDIDIPASEVAEKLNLIGIETTVYKFGNYIPNITTVKILSVEKHPEKDK
LFVCKVSDGEREYQVITGADNVKAGSVVILAQPGAVILGKEIKPVKFGSISSEGMLLSLQ
ELGLEEKSDGIFLLDEDTPIGVDANKVLDIGSDDIFEIEITPNRGDVLSVKGLSREIAAA
FGLKRKDYYPQLPSVENSIEINIQTDKVLRYKATVIKGIKVKQSPLSVRLKLIKSGLSVI
NNIVDITNYILLQEGQPLHAFDLDKIEGKITVRNAFEGEKILTLDGQERVLTNQDIVIAD
DKKPLAIAGVIGGENSKIDQNTQNILLESAVFDPTSVRKTAKRLSILTDSSYRFERGVDI
ENCSTASDKAVSLILSLAGGEVKTVKDLYLKPYQPKTVVLRPSFIEKILGSKIEDETTIK
ILTGLEIPVEKEGEEFKVHIPSFRSYDLEREIDLVEEVARVYGYDKFEEDYPKIPTKIFS
KPKDYEFDTKVRQFFLNSGFTEVLNYTFTSPDFYNTLSLPLPKIHIQNYILKSQSVMRDT
VVVSLIQNQVENLRFGRKDLSIFELSSTFFDDHESINVAGLVSGKLVDGYNYTSPIRSFS
TNRDWDFLSLKGVIDNFLTFLGLDYLVSDENLPVFLHPYESANIIVMGYTVGYVGKIHPK
VAAEFEIPKNTFVFELKLKYVPRDINENPLKEGYIYTYYLNKRPIIYKEIPKYPPVKRDL
AFVIDVNLKVGNLIEDLKKASNLVKNIKLFDVYFLSNSRKSVAVSVEFLHPDKNLSDEEV
NLEVEEILNKLKLIYPDIELRK
Download sequence
Identical sequences C1DTM2
204536.SULAZ_0467 WP_012674965.1.69036 gi|225848296|ref|YP_002728459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]