SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_0718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204669.Acid345_0718
Domain Number 1 Region: 86-275
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.31e-66
Family B3/B4 domain of PheRS, PheT 0.00000914
Further Details:      
 
Domain Number 2 Region: 348-565
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-45
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 3 Region: 573-663
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.09e-19
Family Anticodon-binding domain of PheRS 0.002
Further Details:      
 
Domain Number 4 Region: 288-356
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.38e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0013
Further Details:      
 
Domain Number 5 Region: 1-75
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000238
Family Domains B1 and B5 of PheRS-beta, PheT 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_0718
Sequence length 671
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MRILPNWIRDFVDTKANDHDLAESLTHAGIAVESIVEEHGHTIYEMDLTTNRVDAMNHYG
VAREASAIFDIELKPVTPKLPKAEGTAKFAIELEDAQGCPRYTARIVRGVKVASSPKNIA
QRLELLGSRAINNIADASNYALFEIGHPTHAFDLDTLEGGKIVVRRAREGETLKTLDGET
RKLTSQDLVIADAVKAVALAGVMGGFDTMITEKTTNVLIESAWFDPASIRHTAKRLGMHT
DASHRYERGADIAITALACDRVAELILETAGGKLEGEKIDAIARKIEPRTVQLRRSEVKR
HLGLDLPEQEIERILRRLGFGVDGETVTIPSWRLDVEREIDVIEELARIHGYNNFPNTLP
SFAGGVIELPDEQKRARVREILLALGYNEAISLTFASKEDAAQFGGGEPLAIANPLNEEQ
GYLRTSLLPGMLGMIAYNLNRGNTDVRLFESGDVFEKTGERFEERRRLCFAATGNSIEAS
VHTKAKATDFFDLKGDVEDLLAAFTKRTVYFDTLVPEYYHPGRAARIVLDGATVGYVGQL
HPSVADVRKLKQDVYLAEILQERLFQHDLKAPRFTAISRYPAVERDFSFVFDDAVTFDRV
REAVEALGITEMTSFQAVEIFRGGSVPAGKYSFLVRAAFQSAERTLRDEEVANWSGQIIK
ALEILGGALRG
Download sequence
Identical sequences Q1ITS7
gi|94967749|ref|YP_589797.1| 204669.Acid345_0718 WP_011521525.1.86553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]