SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204773.HEAR1305 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204773.HEAR1305
Domain Number 1 Region: 162-349
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.8e-71
Family Methylesterase CheB, C-terminal domain 0.000000225
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily CheY-like 1.02e-28
Family CheY-related 0.00000711
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 204773.HEAR1305
Sequence length 358
Comment (Herminiimonas arsenicoxydans)
Sequence
MKIKVLIVDDSALIRSVMKEIINSQPDMEVVGVAPDPIIARDLIKQTNPDVLTLDVEMPR
MDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAIDFVTKPKMSIQSGMLEYTE
MIADKIRAASKARIKARHIPTEAHKSTGGEALPLIRNPLTSSEKLIIIGASTGGTEAIKD
FLMQMPSDCPGILITQHMPPGFTKSFAQRLDSLCKIDVKESEGGERVLPGHAYLAPGHSH
LQLVRSGANYMTQLDQGPPVNRHRPSVDVLFHSAAVHAGKNAVGVILTGMGKDGALGMLE
MKNAGAYNFAQDEASCVVFGMPREAIAVGATHEVGSLNALPGIVLGHLATNSSRALRV
Download sequence
Identical sequences A4G4P1
204773.HEAR1305 WP_011870813.1.36655 gi|134094530|ref|YP_001099605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]