SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_0211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_0211
Domain Number 1 Region: 32-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.71e-41
Family Phosphate binding protein-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_0211
Sequence length 337
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MNLPFKRVISLFAAPALAGLLAFSAQADELKEIRIAVPDLSAGTQHSGGGIVDVLRDQQI
FEKAFADQGIKIQWSFFKGAGPVINEAFANGQVDLAYLGDLAAIIGKSNGLDTRLLSASA
RGVKQYLGVVPGSGIKTLQDLKGKRVAIFRGTATQLSFDAALASVGLSEKDVKVINLDFN
AAVAALAAKQIDASWGSSGLTALQAKGLAELPLNTKDLGGAGSVQSVLVGTGKFVDGHPE
AVAKLLKAQQQAVEWLTQDSNKDAYVQLVSGLASYPPVILTQDLKDQNLSEVFPSTLDPL
FLENLQGKVDLAAQQKLIRKPFKVNEWVAPELAAAKL
Download sequence
Identical sequences A0A2A5R566 A0A2K4HUA6 Q3KJV1
205922.Pfl01_0211 gi|77456439|ref|YP_345944.1| WP_011331920.1.15864 WP_011331920.1.22023 WP_011331920.1.2668 WP_011331920.1.30523 WP_011331920.1.32803 WP_011331920.1.46399 WP_011331920.1.47897 WP_011331920.1.53106 WP_011331920.1.58965 WP_011331920.1.96080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]