SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_0215 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_0215
Domain Number 1 Region: 92-298
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.23e-29
Family Phosphate binding protein-like 0.0064
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.03e-20
Family LysR-like transcriptional regulators 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_0215
Sequence length 314
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MHIDLRQLRHFIALAEQRSFVAGAQAVNLSQSAFSRSIQALEHSVGCQLVDRGRKELPPT
KQGQVLLEHARRLVSGAQQMANEISQFNGLEAGELRFGCGPAPAAGLIPRAIGSFIGRYP
KARVHYQVDDWQSLSKRLLSEEFEFFVADTRHFEADPDYLTHRLRPRKWHFCCRAGHPLG
AFERVTAEQLMSYPLAVSIRPPNLRKVIVDLSGRPDFVPNVECENSASLLGVVLRSDAIG
IVGAYSDALHQARGELVCLKVEGLADDLEELYTRYGIVSRAGYRLSPLAEAMIEQIKAID
AVEEEVCSLANLAV
Download sequence
Identical sequences Q3KJU7
WP_011331923.1.2668 gi|77456443|ref|YP_345948.1| 205922.Pfl01_0215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]