SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_2190 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_2190
Domain Number 1 Region: 90-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-31
Family Phosphate binding protein-like 0.0051
Further Details:      
 
Domain Number 2 Region: 1-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000871
Family LysR-like transcriptional regulators 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_2190
Sequence length 297
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MRLRHIEVIQALLQTGHVGTAAEWLQLPAPEVEERLREAESQLGFMLFASVRGRLQPTPE
ARALQVEIGHIYEALEPVQRLASSLKQYLAPPLRIIGTPPLAQQLLPQSLAALRRCLPDV
PCTLLSEPTRDIVRHLLLRDSDLGLSLHDPQHPDIDCQPLAQGKLQLLAPHGWLQPKQKY
ISLQDLAGQAMVGLEGQDPLSPALENKLQALRPAPTIQTRVQTHQMMRSMVEAGEGLAIV
DPFTALGARAGGLDVCPLSPAVPISLYALTFKHATPSAAIQTLLGIVTEQAEAMLAN
Download sequence
Identical sequences Q3KE73
WP_011333619.1.2668 205922.Pfl01_2190 gi|77458417|ref|YP_347922.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]