SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_3161 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_3161
Domain Number 1 Region: 59-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.44e-38
Family Phosphate binding protein-like 0.012
Further Details:      
 
Domain Number 2 Region: 372-464
Classification Level Classification E-value
Superfamily NosL/MerB-like 0.00000000000889
Family NosL-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_3161
Sequence length 467
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MLRAAIAGLVLASFTLSASAETIRIAIGTQDTTINCAAGGLLIRELGLLDKYLPHDGAYK
DARYDVQWKNFTSGAPLTNEMVAGKLDFGAMADFPGAFNGVAFETAGKHSLFISVLSGSI
KGSGNGIVVPSASGVQSLSELKGKTISVPFASTAHGMLLRAVAEQGWDPLKDVNIIAQPP
EVAGSALQAGKIDAHADFVPFAELFPSRGFARKIYDGAQANAPTFHGALVDQAYARKYPE
IVVAYLRASIEANQLLAAEPEKYSELIAKVTGVDAEVNYLFHGPLGVQTRDLSWKPEYRQ
AVGTAIDTLKLLKKADRGLDLNTFIDDQYIRAAFKASNLDYTAQLANYAQTPLKSQDALT
GKAITDFSHVAEIWVRGEDKVRRYASAEEAFTALAGLKSEGKNIRAVYAQASDSGIKLLA
EQAWFASDAKGRLSAFLLKGQAQQFATAQGGKVLDFTDATTQAVATR
Download sequence
Identical sequences Q3KBF5
205922.Pfl01_3161 gi|77459383|ref|YP_348890.1| WP_011334544.1.2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]