SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_4338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_4338
Domain Number 1 Region: 91-288
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-26
Family Phosphate binding protein-like 0.0079
Further Details:      
 
Domain Number 2 Region: 5-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.29e-17
Family LysR-like transcriptional regulators 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_4338
Sequence length 290
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MNFNSESIELFLAVIERGSFSAAARALGKVPSAVSMAIGNLEAELGYALFDRSHREPQPT
AMALSLVPHARLIADQLKQLQVHAVQLSLGLESKLSIGVAADIDRRRLLAAIKDLSERHP
LLDIEVLTAPQDDVLAMLHSGRVSVCLAFAGLSVNVLERFQFVGSERMIATLAADSPLLQ
GQDLFLEDLVHVRQIVVGSRDLPISETRPLVAESHWRTDNLETALEMVETGLGWGNFPLS
VVQPWLDSGRLKRLNFRNIENGLVLPVHAVWLKSQPLQKGALALVELLGG
Download sequence
Identical sequences Q3K829
gi|77460559|ref|YP_350066.1| 205922.Pfl01_4338 WP_011335584.1.2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]