SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 207559.Dde_1700 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  207559.Dde_1700
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 1.15e-17
Family Chemotaxis protein CheA P1 domain 0.007
Further Details:      
 
Domain Number 2 Region: 492-580
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000104
Family Anti-sigma factor antagonist SpoIIaa 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 207559.Dde_1700
Sequence length 596
Comment (Desulfovibrio desulfuricans G20)
Sequence
MQEWRIFLPNSREDIRQAFFDDAQNHLAAMGVLLLELEVAGKDADHELLDGLLRAAHALK
CSAGFLDYRRAFTLARALESFLDMWREGTLVPDESTAARVEKAFDILAVLLTPSGTSESE
QAARSEKSAEAEALAAVLDAAGGVEENGGGTQCPAQYRVYAPDGALVFEGHCPDLHLAGK
TGSNLYVLEFIYEEDLNRKDLSPQALLGFLQKSGYILAIGGRTVPVGYEPADVLCVLYAS
FLEKDLIAAVFQIAAEKVHPVDLQDLLAGEAMWQAAVVKDAEDALLHAVREPHKDSVDEL
VRQYDNAMEKLRAASDEDKEPLEGWDIEAVVSLGNGGEVADPFCMAVELHAADPAGAENT
AYDATAASDCAVARGQTADADEAGLVAEFEDSFMEDEAELLLNELPEEHPLRAAYEAEPQ
GDEEFFRDTEEQPDLSYLNEALPDETPAGGVVFDLAMPVAESDTGLQSASLQDAKHKGEA
EMIAGFAVGPAQDGNAGVLQLAGDITIERSAQLQEAFQEALSRYEVLRIDSQQLESADLT
LVQLLCAAAAQAKERGGRLESEGLPSAGLMQTLVLAGFDDAAMKRRGLETFTGSGD
Download sequence
Identical sequences 207559.Dde_1700 WP_041276865.1.27936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]