SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 207559.Dde_1897 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  207559.Dde_1897
Domain Number 1 Region: 32-94
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000353
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 207559.Dde_1897
Sequence length 118
Comment (Desulfovibrio desulfuricans G20)
Sequence
MKYGLITVLICIVLYEIFEHLILPLFWMIRYRKRNSACGPEGMIGKICKVQQWNGTSGKV
KVGAELWNASSPSPLIPGDEPVIKSIEGLTLRVSSQSERLPDLPIKRFDKDHADDSSK
Download sequence
Identical sequences Q310F2
WP_011367817.1.27936 gi|78356940|ref|YP_388389.1| 207559.Dde_1897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]